JustPaste.it

Top Crypto VCs Mine GitHub and Grants. Are You Sourcing the Same Way?

The best pre-seed deals in crypto do not start with a pitch deck. They start with a GitHub commit pushed at 2 a.m., a domain registered three months before any announcement, or a grant application filed quietly with a protocol foundation. 

By the time a founder shows up in your inbox, the funds that got in early already have the position, often at a fraction of your entry price.

githubcommitsdomainregistrationsgrantdatabasesthenonobviousdatasources_crmmanagedserviceskeytakeaways.png

This is where most crypto VC sourcing strategies break down. 

Firms are still optimizing for inbound quality when the real edge sits in unstructured signal detection. GenAI-driven CRM managed services are now helping investment teams convert those scattered digital footprints into structured founder intelligence, intent-based scoring, and a sourcing engine that compounds over time.

Why Are the Most Fundable Crypto Founders Invisible Until It's Too Late?

Stealth-mode founders building in crypto are not hiding, they are just not where most VCs look. The signals exist, they are public, but the problem is they live in formats that do not map cleanly to a CRM row or a deal pipeline.

Here’s what a pre-seed crypto founder typically leaves behind before their first investor conversation:

  • GitHub repositories with commit frequency, contributor overlap, and code quality indicators

  • Newly registered domains often bearing protocol names, even if not yet publicly announced

  • Grant applications submitted to foundations like Ethereum Foundation, Optimism, or Arbitrum, often peer-reviewed and publicly accessible

  • Academic co-authorship patterns that reveal research alignment and technical depth

  • Hiring signals on LinkedIn or job boards that indicate team formation before any public announcement

None of these are secrets but extracting them, normalizing them, and connecting them to a specific founder profile requires processing capacity that manual research simply cannot sustain at scale. 

A recent survey of nearly 300 private capital dealmakers found that 82% of firms are now using AI for deal sourcing research, which means the firms not doing this are already behind the adoption curve.

The deeper issue is structural because most VC CRMs are built for inbound management. They capture what founders send you, instead of what founders are doing.

How Do You Turn Unstructured Digital Signals Into Actionable Founder Intelligence?

This is where GenAI-driven CRM managed services create real differentiation. The goal is to build a system that scores and surfaces the right founders before they enter a competitive process.

The workflow looks like this in practice:

  • Signal ingestion: Trained research analysts, working with GenAI tooling, scan sources including GitHub activity, domain registration databases, grant application archives, and academic preprint servers. They require contextual judgment to separate noise from intent.

  • Founder profile construction: Raw signals get merged into structured records, linked by person. A founder who contributed to an Ethereum research paper in Q1, registered a domain in Q2, and opened a public GitHub repo in Q3 is showing a clear intent arc. That arc is invisible if those data points live in silos.

  • Founder intent scoring: A domain registration paired with active protocol grant applications and a team of known contributors scores differently from a solo repo with no corresponding network activity. Intent scoring models built on CRM data let partners prioritize outreach without reviewing every signal manually.

  • Continuous enrichment: Founder profiles should not be static. Ongoing data maintenance including deduplication, field appending (job titles, affiliated protocols, co-investor relationships), and contact verification keeps the sourcing engine current. Stale data produces outdated outreach and missed timing windows.

Bessemer Venture Partners reclaimed 234 hours per analyst after integrating AI into their workflows. That gets redirected toward the relationship work that closes rounds.

githubcommitsdomainregistrationsgrantdatabasesthenonobviousdatasources_crmmanagedservicesimage.png

What Does Automated Relationship Intelligence Actually Look Like in a Crypto VC Context?

The sourcing engine only works if the relationship layer keeps pace with it. Finding a founder early means nothing if the firm cannot track touchpoints, warm the relationship over time, and surface the right moment to engage.

Here CRM-native relationship intelligence becomes the connective tissue between deal sourcing and deal closing.

Automated relationship intelligence in a crypto VC context involves:

  • Communication history tracking across email, calendar, and messaging platforms, so no partner walks into a conversation without full context on prior interactions

  • Interaction preference mapping that notes how a founder communicates (async vs. sync, technical depth vs. high-level), allowing outreach to feel considered rather than templated

  • Co-investor and co-author relationship mapping to identify warm paths into founder networks that are not immediately obvious from a firm's existing network

  • LP relationship tracking as a parallel workflow, managing limited partner communication cadences, preferences, and reporting cycles alongside founder sourcing

A two-person BD team at Notable Capital manages 500+ introductions annually with AI-powered workflows. The leverage comes from removing the administrative friction that slows it down.

The failure mode at most firms is fragmentation: 

Sourcing signals in one tool, founder communication in email, LP tracking in a spreadsheet, and deal status in a separate pipeline system. When those systems do not talk to each other, relationship data degrades the moment it is created.

How Do You Build a Sourcing Engine That Gets Better Over Time and Faster?

Speed is the entry-level benefit of AI-assisted sourcing. The compounding advantage comes from building a system that learns from every interaction, every deal outcome, and every founder profile it processes.

A continuously learning sourcing engine has three structural requirements:

  • Clean, governed data: Regular database scrubbing, deduplication, and format standardization are not optional maintenance tasks. They are the foundation of reliable intent scoring. Analysts who manage this work like validating contacts, appending missing fields, and consolidating company records determine whether the system surfaces signal or noise.

  • Feedback loops from deal outcomes: When a deal closes or a founder turns out to be outside the thesis, that judgment needs to flow back into the scoring model. This requires CRM configurations that capture outcome data systematically.

  • Cross-cluster founder discovery: Non-obvious founder clusters often emerge from unexpected overlaps such as researchers transitioning from TradFi into DeFi, protocol contributors from underrepresented geographies, second-time founders who exited quietly. Surfacing these clusters requires the system to look for pattern similarity across profiles.

Firms using AI at scale have achieved a 5x increase in research throughput, analyzing 10 to 15 companies daily versus the 2 to 3 that were possible with manual processes. That throughput, applied to pre-seed crypto sourcing, means the gap between early-access investors and everyone else widens every quarter.

Addressing Some Frequently Asked Questions (FAQs)

Q: Can GenAI tools reliably parse GitHub activity as a pre-seed investment signal? 

Yes, but with caveats. Commit frequency, contributor diversity, and code quality are readable signals. The judgment layer, determining whether that activity maps to a viable founding team, still requires analyst review.

Q: How do you avoid false positives in founder intent scoring? 

By weighting multi-source signal convergence over single-source activity. A domain registration alone is weak. The same domain, paired with a grant application and GitHub contributor overlap with known protocol builders, is much stronger.

Q: What CRM configurations matter most for crypto VC sourcing? 

Custom fields mapped to crypto-specific data points such as protocol affiliations, on-chain identifiers, grant history, and token economics background make a significant difference. Generic VC CRM templates are not built for this.

If you are building or refining a crypto VC sourcing system and want to move beyond inbound-only deal flow, CLICK HERE to explore how BizKonnect's GenAI-driven CRM managed services can help you convert unstructured founder signals into a structured, compounding sourcing advantage.